SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lega_ (4leg A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155438Species Human (Homo sapiens) [TaxId:9606] [187072] (40 PDB entries)
  8. 2155502Domain d4lega_: 4leg A: [236776]
    automated match to d3of8a_
    complexed with 1xf, act, gol, so4; mutant

Details for d4lega_

PDB Entry: 4leg (more details), 2.6 Å

PDB Description: human cathepsin k mutant c25s in complex with an allosteric modifier
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d4lega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lega_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d4lega_:

Click to download the PDB-style file with coordinates for d4lega_.
(The format of our PDB-style files is described here.)

Timeline for d4lega_: