| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
| Protein Retroviral integrase, catalytic domain [53108] (5 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries) |
| Domain d3l3ua_: 3l3u A: [236775] automated match to d3ao1a_ complexed with so4 |
PDB Entry: 3l3u (more details), 1.4 Å
SCOPe Domain Sequences for d3l3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l3ua_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd
Timeline for d3l3ua_: