SCOPe 2.03: Domain d3l3ub_: 3l3u B:

Lineage for d3l3ub_ (3l3u B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (37 PDB entries)

8. Domain d3l3ub_: 3l3u B: [236773]
   automated match to d3ovnb_
   complexed with so4

Details for d3l3ub_

PDB Entry: 3l3u

PDB Description: crystal structure of the hiv-1 integrase core domain to 1.4a

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3l3ub_:

Sequence, based on SEQRES records:

>d3l3ub_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3l3ub_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedggviesmnkelkkiigqvrdqaehlktavqmavfihn
hkrkggiggysagerivdiiatdiq

Timeline for d3l3ub_:

• d3l3ub_ is new in SCOPe 2.03-stable
  
• d3l3ub_ appears in SCOPe 2.04
  
• d3l3ub_ appears in the current release, SCOPe 2.08