SCOPe 2.06: Domain d4l57b_: 4l57 B:

Lineage for d4l57b_ (4l57 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein automated matches [190171] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186899] (17 PDB entries)

8. Domain d4l57b_: 4l57 B: [236770]
   automated match to d2i7da_
   complexed with gol, mg, na, po4

Details for d4l57b_

PDB Entry: 4l57, 1.08 Å

PDB Description: high resolutin structure of human cytosolic 5'(3')- deoxyribonucleotidase

PDB Compounds: (B:) 5'(3')-deoxyribonucleotidase, cytosolic type

SCOPe Domain Sequences for d4l57b_:

Sequence; same for both SEQRES and ATOM records:

>d4l57b_ c.108.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkvas
vyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgpq
fveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrllsw
sdnwreildskr

Timeline for d4l57b_:

• d4l57b_ first appeared in SCOPe 2.03
  
• d4l57b_ appears in SCOPe 2.05
  
• d4l57b_ appears in SCOPe 2.07
  
• d4l57b_ appears in the current release, SCOPe 2.08