SCOP 1.57: Domain d1shsc_: 1shs C:

Lineage for d1shsc_ (1shs C:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)

4. Superfamily b.15.1: HSP20-like chaperones [49764] (2 families)

5. Family b.15.1.1: HSP20 [49765] (1 protein)

6. Protein Small heat shock protein [49766] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [49767] (1 PDB entry)

8. Domain d1shsc_: 1shs C: [23677]

Details for d1shsc_

PDB Entry: 1shs, 2.9 Å

PDB Description: small heat shock protein from methanococcus jannaschii

SCOP Domain Sequences for d1shsc_:

Sequence; same for both SEQRES and ATOM records:

>d1shsc_ b.15.1.1 (C:) Small heat shock protein {Archaeon Methanococcus jannaschii}
tgiqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmitese
riiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

Timeline for d1shsc_:

• d1shsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1shsc_ appears in SCOP 1.59
  
• d1shsc_ appears in the current release, SCOPe 2.08