Lineage for d1shsa_ (1shs A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12002Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
  4. 12003Superfamily b.15.1: HSP20-like chaperones [49764] (2 families) (S)
  5. 12004Family b.15.1.1: HSP20 [49765] (1 protein)
  6. 12005Protein Small heat shock protein [49766] (1 species)
  7. 12006Species Methanococcus jannaschii [TaxId:2190] [49767] (1 PDB entry)
  8. 12007Domain d1shsa_: 1shs A: [23675]

Details for d1shsa_

PDB Entry: 1shs (more details), 2.9 Å

PDB Description: small heat shock protein from methanococcus jannaschii

SCOP Domain Sequences for d1shsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Methanococcus jannaschii}
tgiqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmitese
riiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

SCOP Domain Coordinates for d1shsa_:

Click to download the PDB-style file with coordinates for d1shsa_.
(The format of our PDB-style files is described here.)

Timeline for d1shsa_: