Lineage for d1df0a2 (1df0 A:356-514)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163859Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
  4. 163860Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (1 family) (S)
  5. 163861Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 163862Protein Calpain large subunit, middle domain (domain III) [49760] (2 species)
  7. 163866Species Rat (Rattus norvegicus) [TaxId:10116] [49762] (1 PDB entry)
  8. 163867Domain d1df0a2: 1df0 A:356-514 [23674]
    Other proteins in same PDB: d1df0a1, d1df0a3, d1df0b_

Details for d1df0a2

PDB Entry: 1df0 (more details), 2.6 Å

PDB Description: crystal structure of m-calpain

SCOP Domain Sequences for d1df0a2:

Sequence, based on SEQRES records: (download)

>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus)}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkh
rrrqrkmgedmhtigfgiyevpeeltgqtnihlsknfflttrarersdtfinlrevlnrf
klppgeyvlvpstfephkngdfcirvfsekkadyqtvdd

Sequence, based on observed residues (ATOM records): (download)

>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus)}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgrgctflvgliqkhr
rrqrkmgedmhtigfgiyevsknffltersdtfinlrevlnrfklppgeyvlvpstfeph
kngdfcirvfsekkadyqtvdd

SCOP Domain Coordinates for d1df0a2:

Click to download the PDB-style file with coordinates for d1df0a2.
(The format of our PDB-style files is described here.)

Timeline for d1df0a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1df0b_