Lineage for d1df0a2 (1df0 A:356-514)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038898Fold b.14: Calpain large subunit, middle domain (domain III) [49757] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2038899Superfamily b.14.1: Calpain large subunit, middle domain (domain III) [49758] (2 families) (S)
    automatically mapped to Pfam PF01067
  5. 2038900Family b.14.1.1: Calpain large subunit, middle domain (domain III) [49759] (1 protein)
  6. 2038901Protein Calpain large subunit, middle domain (domain III) [49760] (3 species)
  7. 2038905Species Norway rat (Rattus norvegicus), M-type [TaxId:10116] [49762] (2 PDB entries)
  8. 2038906Domain d1df0a2: 1df0 A:356-514 [23674]
    Other proteins in same PDB: d1df0a1, d1df0a3, d1df0b_

Details for d1df0a2

PDB Entry: 1df0 (more details), 2.6 Å

PDB Description: Crystal structure of M-Calpain
PDB Compounds: (A:) m-calpain

SCOPe Domain Sequences for d1df0a2:

Sequence, based on SEQRES records: (download)

>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgergctflvgliqkh
rrrqrkmgedmhtigfgiyevpeeltgqtnihlsknfflttrarersdtfinlrevlnrf
klppgeyvlvpstfephkngdfcirvfsekkadyqtvdd

Sequence, based on observed residues (ATOM records): (download)

>d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
wkltkmdgnwrrgstaggcrnypntfwmnpqylikleeededdedgrgctflvgliqkhr
rrqrkmgedmhtigfgiyevsknffltersdtfinlrevlnrfklppgeyvlvpstfeph
kngdfcirvfsekkadyqtvdd

SCOPe Domain Coordinates for d1df0a2:

Click to download the PDB-style file with coordinates for d1df0a2.
(The format of our PDB-style files is described here.)

Timeline for d1df0a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1df0b_