Lineage for d4jzba_ (4jzb A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281954Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1281955Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1282215Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1282216Protein automated matches [196409] (21 species)
    not a true protein
  7. 1282236Species Leishmania major [TaxId:5664] [236738] (3 PDB entries)
  8. 1282239Domain d4jzba_: 4jzb A: [236739]
    automated match to d3id0a_
    complexed with ca, ipe, na, p2h

Details for d4jzba_

PDB Entry: 4jzb (more details), 1.9 Å

PDB Description: crystal structure of leshmaniasis major farnesyl diphosphate synthase in complex with 1-(2-hydroxy-2,2-diphosphonoethyl)-3- phenylpyridinium, ipp and ca2+
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4jzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jzba_ a.128.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr
qk

SCOPe Domain Coordinates for d4jzba_:

Click to download the PDB-style file with coordinates for d4jzba_.
(The format of our PDB-style files is described here.)

Timeline for d4jzba_: