Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (11 species) not a true protein |
Species Plasmodium vivax [TaxId:126793] [227874] (2 PDB entries) |
Domain d4jysb_: 4jys B: [236737] automated match to d4dz3b_ complexed with cl, imd |
PDB Entry: 4jys (more details), 1.9 Å
SCOPe Domain Sequences for d4jysb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jysb_ d.26.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]} dkpyvktesgilykdlidgegdpieegdivyihyqgkttndfriihstfnsiippkirag qydqkhiraiyeivigmkkhtrrqcvvpphlaypnhfpsqpllyeidvvkvvkk
Timeline for d4jysb_: