Lineage for d4jysb_ (4jys B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408665Species Plasmodium vivax [TaxId:126793] [227874] (2 PDB entries)
  8. 1408667Domain d4jysb_: 4jys B: [236737]
    automated match to d4dz3b_
    complexed with cl, imd

Details for d4jysb_

PDB Entry: 4jys (more details), 1.9 Å

PDB Description: Crystal structure of FKBP25 from Plasmodium Vivax
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4jysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jysb_ d.26.1.0 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
dkpyvktesgilykdlidgegdpieegdivyihyqgkttndfriihstfnsiippkirag
qydqkhiraiyeivigmkkhtrrqcvvpphlaypnhfpsqpllyeidvvkvvkk

SCOPe Domain Coordinates for d4jysb_:

Click to download the PDB-style file with coordinates for d4jysb_.
(The format of our PDB-style files is described here.)

Timeline for d4jysb_: