SCOPe 2.06: Domain d4jazb_: 4jaz B:

Lineage for d4jazb_ (4jaz B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (113 PDB entries)
   Uniprot P37231 232-505

8. Domain d4jazb_: 4jaz B: [236735]
   automated match to d3adua_
   protein/DNA complex; complexed with stl

Details for d4jazb_

PDB Entry: 4jaz, 2.85 Å

PDB Description: Crystal structure of the complex between PPARgamma LBD and trans-resveratrol

PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d4jazb_:

Sequence; same for both SEQRES and ATOM records:

>d4jazb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiy

Timeline for d4jazb_:

• d4jazb_ first appeared in SCOPe 2.03
  
• d4jazb_ appears in SCOPe 2.05
  
• d4jazb_ appears in SCOPe 2.07
  
• d4jazb_ appears in the current release, SCOPe 2.08