Lineage for d4jkoa_ (4jko A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839223Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 1839333Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 1839334Protein automated matches [191059] (11 species)
    not a true protein
  7. 1839351Species Geobacillus stearothermophilus [TaxId:1422] [236728] (7 PDB entries)
  8. 1839358Domain d4jkoa_: 4jko A: [236730]
    automated match to d1yzfa1
    complexed with gol, po4; mutant

Details for d4jkoa_

PDB Entry: 4jko (more details), 1.9 Å

PDB Description: crystal structure of a catalytic mutant of axe2 (axe2_s15a), an acetylxylan esterase from geobacillus stearothermophilus
PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d4jkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkoa_ c.23.10.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdaitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawdrvhpsvaghmilaraflreigfewvrsr

SCOPe Domain Coordinates for d4jkoa_:

Click to download the PDB-style file with coordinates for d4jkoa_.
(The format of our PDB-style files is described here.)

Timeline for d4jkoa_: