SCOPe 2.08: Domain d4jkoa_: 4jko A:

Lineage for d4jkoa_ (4jko A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (16 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [236728] (8 PDB entries)

8. Domain d4jkoa_: 4jko A: [236730]
   automated match to d1yzfa1
   complexed with gol, po4; mutant

Details for d4jkoa_

PDB Entry: 4jko, 1.9 Å

PDB Description: crystal structure of a catalytic mutant of axe2 (axe2_s15a), an acetylxylan esterase from geobacillus stearothermophilus

PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d4jkoa_:

Sequence; same for both SEQRES and ATOM records:

>d4jkoa_ c.23.10.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdaitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawdrvhpsvaghmilaraflreigfewvrsr

Timeline for d4jkoa_:

• d4jkoa_ first appeared in SCOPe 2.03
  
• d4jkoa_ appears in SCOPe 2.07