Lineage for d3ir1c_ (3ir1 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1391847Species Neisseria meningitidis [TaxId:487] [232610] (1 PDB entry)
  8. 1391850Domain d3ir1c_: 3ir1 C: [236725]
    automated match to d3ir1a_
    complexed with met, so4

Details for d3ir1c_

PDB Entry: 3ir1 (more details), 2.15 Å

PDB Description: Crystal Structure of Lipoprotein GNA1946 from Neisseria meningitidis
PDB Compounds: (C:) Outer membrane lipoprotein GNA1946

SCOPe Domain Sequences for d3ir1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir1c_ c.94.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 487]}
keivfgttvgdfgdmvkeqiqpelekkgytvklveftdyvrpnlalaegeldinvfqhkp
ylddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmld
elgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgm
kltealfqepsfayvnwsavktadkdsqwlkdvteaynsdafkayahkrfegykspaaw

SCOPe Domain Coordinates for d3ir1c_:

Click to download the PDB-style file with coordinates for d3ir1c_.
(The format of our PDB-style files is described here.)

Timeline for d3ir1c_: