![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries) |
![]() | Domain d4io0a1: 4io0 A:1-287 [236722] Other proteins in same PDB: d4io0a2 automated match to d1cqwa_ complexed with rn1, so4; mutant |
PDB Entry: 4io0 (more details), 2.9 Å
SCOPe Domain Sequences for d4io0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4io0a1 c.69.1.0 (A:1-287) automated matches {Bacillus megaterium [TaxId: 1404]} mskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynl sekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliaf ngphpytamrelrtnknqqkaseymkwfqkqevqdymerdnfsglrklvidpgvkkgylt addvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdp tfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk
Timeline for d4io0a1: