Lineage for d4inza_ (4inz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2476522Species Bacillus megaterium [TaxId:1404] [236718] (4 PDB entries)
  8. 2476523Domain d4inza_: 4inz A: [236720]
    automated match to d1cqwa_
    complexed with edo, peg; mutant

Details for d4inza_

PDB Entry: 4inz (more details), 1.7 Å

PDB Description: The crystal structure of M145A mutant of an epoxide hydrolase from Bacillus megaterium
PDB Compounds: (A:) Soluble epoxide hydrolase

SCOPe Domain Sequences for d4inza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inza_ c.69.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
skqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynls
ekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliafn
gphpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfsglrklvidpgvkkgylta
ddvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdpt
fmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk

SCOPe Domain Coordinates for d4inza_:

Click to download the PDB-style file with coordinates for d4inza_.
(The format of our PDB-style files is described here.)

Timeline for d4inza_: