SCOPe 2.08: Domain d3g2da_: 3g2d A:

Lineage for d3g2da_ (3g2d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (14 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)

8. Domain d3g2da_: 3g2d A: [236710]
   automated match to d3g00a_
   protein/DNA complex; complexed with gol, pg4, po4

Details for d3g2da_

PDB Entry: 3g2d, 2.3 Å

PDB Description: complex of mth0212 and a 4 bp dsdna with 3'-overhang

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g2da_:

Sequence; same for both SEQRES and ATOM records:

>d3g2da_ d.151.1.0 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
avlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgnfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel

Timeline for d3g2da_:

• d3g2da_ first appeared in SCOPe 2.03
  
• d3g2da_ appears in SCOPe 2.07