Lineage for d1dhx__ (1dhx -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11975Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 11988Family b.13.2.2: Adenovirus hexon [49753] (1 protein)
  6. 11989Protein Adenovirus hexon [49754] (2 species)
  7. 11990Species Human adenovirus type 2 [TaxId:10515] [49755] (1 PDB entry)
  8. 11991Domain d1dhx__: 1dhx - [23671]

Details for d1dhx__

PDB Entry: 1dhx (more details), 2.9 Å

PDB Description: the refined crystal structure of hexon, the major coat protein of adenovirus type 2, at 2.9 angstroms resolution

SCOP Domain Sequences for d1dhx__:

Sequence, based on SEQRES records: (download)

>d1dhx__ b.13.2.2 (-) Adenovirus hexon {Human adenovirus type 2}
frnptvapthdvttdrsqrltlrfipvdredtaysykarftlavgdnrvldmastyfdir
gvldrgptfkpysgtaynalapkgapnsceweqtedsgravaedeeeededeeeeeeeqn
ardqatkkthvyaqaplsgetitksglqigsdnaetqakpvyadpsyqpepqigesqwne
adanaaggrvlkkttpmkpcygsyarptnpfggqsvlvpdekgvplpkvdlqffsnttsl
ndrqgnatkpkvvlysedvnmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdn
figlmyynstgnmgvlagqasqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavd
sydpdvriienhgtedelpnycfplggigvtdtyqaikangngsgdngdttwtkdetfat
rneigvgnnfameinlnanlwrnflysnialylpdklkynptnveisdnpntydymnkrv
vapglvdcyinlgarwsldymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffa
iknllllpgsytyewnfrkdvnmvlqsslgndlrvdgasikfdsiclyatffpmahntas
tleamlrndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktket
pslgsgydpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrs
vdgegynvaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvdd
tkykeyqqvgilhqhnnsgfvgylaptmregqaypanvpypligktavdsitqkkflcdr
tlwripfssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrv
hqphrgvietvylrtpfsagnatt

Sequence, based on observed residues (ATOM records): (download)

>d1dhx__ b.13.2.2 (-) Adenovirus hexon {Human adenovirus type 2}
frnptvapthdvttdrsqrltlrfipvdredtaysykarftlavgdnrvldmastyfdir
gvldrgptfkpysgtaynalapkgapnsceweqtedsgravaedeeeededeeeeeeeqn
ardqatkkthvyaqaplsgetitksglqigsdnaetqakpvyadpsyqpepqigesqwne
adanaaggrvlkkttpmkpcygsyarptnpfggqsvlvpdekgvplpkvkpkvvlysedv
nmetpdthlsykpgkgdenskamlgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagq
asqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelp
nycfplggigvtdtyqaikangngsgdngdttwtkdetfatrneigvgnnfameinlnan
lwrnflysnialylpdklkynptnveisdnpntydymnkrvvapglvdcyinlgarwsld
ymdnvnpfnhhrnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrk
dvnmvlqsslgndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndyl
saanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipy
ldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwfl
vqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykeyqqvgilhqhnnsg
fvgylaptmregqaypanvpypligktavdsitqkkflcdrtlwripfssnfmsmgaltd
lgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhqphrgvietvylrtpfsa
gnatt

SCOP Domain Coordinates for d1dhx__:

Click to download the PDB-style file with coordinates for d1dhx__.
(The format of our PDB-style files is described here.)

Timeline for d1dhx__:

  • d1dhx__ does not appear in SCOP 1.57