SCOPe 2.08: Domain d4c83d1: 4c83 D:2-107

Lineage for d4c83d1 (4c83 D:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4c83d1: 4c83 D:2-107 [236700]
   Other proteins in same PDB: d4c83a_, d4c83c_
   automated match to d1n0xl1
   complexed with so4

Details for d4c83d1

PDB Entry: 4c83, 2.69 Å

PDB Description: crystal structure of the igg2a lpt3 in complex with an 8-sugar inner core analogue of neisseria meningitidis

PDB Compounds: (D:) lpt3 light chain

SCOPe Domain Sequences for d4c83d1:

Sequence; same for both SEQRES and ATOM records:

>d4c83d1 b.1.1.0 (D:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivlsqspaimsaspgekvtmtcsasssvrymhwyqqksgtspkrwiydtsklasgvptrf
sgsgsgtsyslpissmeaedgasyycqqwngyppltfgggtklemk

Timeline for d4c83d1:

• d4c83d1 first appeared in SCOPe 2.03
  
• d4c83d1 appears in SCOPe 2.07