Lineage for d1hqnc_ (1hqn C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11975Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 11976Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 11977Protein Coat protein p3 [49751] (1 species)
  7. 11978Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 11987Domain d1hqnc_: 1hqn C: [23670]

Details for d1hqnc_

PDB Entry: 1hqn (more details), 2.2 Å

PDB Description: the selenomethionine derivative of p3, the major coat protein of the lipid-containing bacteriophage prd1.

SCOP Domain Sequences for d1hqnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqnc_ b.13.2.1 (C:) Coat protein p3 {Bacteriophage prd1}
alrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvt
aaitnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssm
vtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlk
lefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplid
lstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanf
sdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarl
lmgyeyftsrte

SCOP Domain Coordinates for d1hqnc_:

Click to download the PDB-style file with coordinates for d1hqnc_.
(The format of our PDB-style files is described here.)

Timeline for d1hqnc_:

  • d1hqnc_ does not appear in SCOP 1.57