Lineage for d4cewc_ (4cew C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812436Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1812437Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1812715Protein automated matches [190854] (11 species)
    not a true protein
  7. 1812752Species Human enterovirus 71 [TaxId:39054] [195913] (11 PDB entries)
  8. 1812771Domain d4cewc_: 4cew C: [236699]
    Other proteins in same PDB: d4cewa_, d4cewb_
    automated match to d3vbfc_
    complexed with 7j5

Details for d4cewc_

PDB Entry: 4cew (more details), 2.75 Å

PDB Description: crystal structure of human enterovirus 71 in complex with the uncoating inhibitor ald
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d4cewc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cewc_ b.121.4.1 (C:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
iq

SCOPe Domain Coordinates for d4cewc_:

Click to download the PDB-style file with coordinates for d4cewc_.
(The format of our PDB-style files is described here.)

Timeline for d4cewc_: