SCOPe 2.04: Domain d4cdqc_: 4cdq C:

Lineage for d4cdqc_ (4cdq C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (9 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [195913] (10 PDB entries)

8. Domain d4cdqc_: 4cdq C: [236692]
   Other proteins in same PDB: d4cdqa_
   automated match to d3vbfc_
   complexed with 7vr, na

Details for d4cdqc_

PDB Entry: 4cdq, 2.65 Å

PDB Description: crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp2

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d4cdqc_:

Sequence; same for both SEQRES and ATOM records:

>d4cdqc_ b.121.4.1 (C:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
iq

Timeline for d4cdqc_:

• d4cdqc_ first appeared in SCOPe 2.03
  
• d4cdqc_ appears in SCOPe 2.05
  
• d4cdqc_ appears in the current release, SCOPe 2.08