Lineage for d4cdqc_ (4cdq C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2822070Protein automated matches [190854] (27 species)
    not a true protein
  7. 2822193Species Human enterovirus 71 [TaxId:39054] [195913] (16 PDB entries)
  8. 2822199Domain d4cdqc_: 4cdq C: [236692]
    Other proteins in same PDB: d4cdqa_, d4cdqb_
    automated match to d3vbfc_
    complexed with 7vr, na

Details for d4cdqc_

PDB Entry: 4cdq (more details), 2.65 Å

PDB Description: crystal structure of human enterovirus 71 in complex with the uncoating inhibitor gpp2
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d4cdqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdqc_ b.121.4.1 (C:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
iq

SCOPe Domain Coordinates for d4cdqc_:

Click to download the PDB-style file with coordinates for d4cdqc_.
(The format of our PDB-style files is described here.)

Timeline for d4cdqc_: