![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
![]() | Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) ![]() automatically mapped to Pfam PF02531 |
![]() | Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
![]() | Protein automated matches [236562] (1 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [236566] (1 PDB entry) |
![]() | Domain d4kt0d_: 4kt0 D: [236685] Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0e_, d4kt0f_, d4kt0j_ automated match to d1jb0d_ complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4 |
PDB Entry: 4kt0 (more details), 2.8 Å
SCOPe Domain Sequences for d4kt0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt0d_ d.187.1.1 (D:) automated matches {Synechocystis sp. [TaxId: 1148]} elsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylark eqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrri gqnpepvtikfsgkapye
Timeline for d4kt0d_: