| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
| Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
| Protein automated matches [236583] (1 species) not a true protein |
| Species Synechocystis sp. [TaxId:1148] [236584] (1 PDB entry) |
| Domain d4kt0f_: 4kt0 F: [236683] Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0e_, d4kt0j_ automated match to d1jb0f_ complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4 |
PDB Entry: 4kt0 (more details), 2.8 Å
SCOPe Domain Sequences for d4kt0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt0f_ f.23.16.1 (F:) automated matches {Synechocystis sp. [TaxId: 1148]}
dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
vgeytsgklvmkdseiptspr
Timeline for d4kt0f_: