Lineage for d4kt0f_ (4kt0 F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026109Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 3026110Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 3026117Protein automated matches [236583] (4 species)
    not a true protein
  7. 3026125Species Synechocystis sp. [TaxId:1148] [236584] (1 PDB entry)
  8. 3026126Domain d4kt0f_: 4kt0 F: [236683]
    Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0e_, d4kt0j_
    automated match to d1jb0f_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0f_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (F:) Photosystem I subunit III

SCOPe Domain Sequences for d4kt0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0f_ f.23.16.1 (F:) automated matches {Synechocystis sp. [TaxId: 1148]}
dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
vgeytsgklvmkdseiptspr

SCOPe Domain Coordinates for d4kt0f_:

Click to download the PDB-style file with coordinates for d4kt0f_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0f_: