![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (88 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries) |
![]() | Domain d3zlhb1: 3zlh B:1-139 [236677] Other proteins in same PDB: d3zlha2, d3zlha3, d3zlhb2, d3zlhb3, d3zlhc2, d3zlhc3, d3zlhd2, d3zlhd3 automated match to d1p43a2 |
PDB Entry: 3zlh (more details), 2.9 Å
SCOPe Domain Sequences for d3zlhb1:
Sequence, based on SEQRES records: (download)
>d3zlhb1 d.54.1.0 (B:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]} msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl glgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavar aaadylevplytylggfnt
>d3zlhb1 d.54.1.0 (B:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]} msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastheavelrdgdksrylgl gtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraa adylevplytylggfnt
Timeline for d3zlhb1: