| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries) |
| Domain d3zlfa1: 3zlf A:1-139 [236671] Other proteins in same PDB: d3zlfa2, d3zlfa3, d3zlfb2, d3zlfb3, d3zlfc2, d3zlfc3, d3zlfd2, d3zlfd3 automated match to d1p43a2 complexed with po4; mutant |
PDB Entry: 3zlf (more details), 2.15 Å
SCOPe Domain Sequences for d3zlfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zlfa1 d.54.1.0 (A:1-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggfnt
Timeline for d3zlfa1: