Lineage for d1cjdc_ (1cjd C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11975Superfamily b.13.2: Viral proteins [49749] (2 families) (S)
  5. 11976Family b.13.2.1: Coat protein p3 [49750] (1 protein)
  6. 11977Protein Coat protein p3 [49751] (1 species)
  7. 11978Species Bacteriophage prd1 [TaxId:10658] [49752] (3 PDB entries)
  8. 11984Domain d1cjdc_: 1cjd C: [23667]

Details for d1cjdc_

PDB Entry: 1cjd (more details), 1.85 Å

PDB Description: the bacteriophage prd1 coat protein, p3, is structurally similar to human adenovirus hexon

SCOP Domain Sequences for d1cjdc_:

Sequence, based on SEQRES records: (download)

>d1cjdc_ b.13.2.1 (C:) Coat protein p3 {Bacteriophage prd1}
rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqngyilplidls
tlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfsd
trkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarllm
gyeyftsrt

Sequence, based on observed residues (ATOM records): (download)

>d1cjdc_ b.13.2.1 (C:) Coat protein p3 {Bacteriophage prd1}
rnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpanvgivkgflvkvtaa
itnnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvntakqgapflssmvt
dspikygdvmnvidapatiaagatgeltmyywvplaysetdltgavlanvpqskqrlkle
fannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlpvgqyilplidlstl
ynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdinylsqrtanfsdtr
kldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnpktvnqnarllmgy
eyftsrt

SCOP Domain Coordinates for d1cjdc_:

Click to download the PDB-style file with coordinates for d1cjdc_.
(The format of our PDB-style files is described here.)

Timeline for d1cjdc_:

  • d1cjdc_ does not appear in SCOP 1.57