Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Streptococcus pyogenes [TaxId:286636] [236667] (3 PDB entries) |
Domain d3zlfb2: 3zlf B:140-433 [236668] Other proteins in same PDB: d3zlfa1, d3zlfa3, d3zlfb1, d3zlfb3, d3zlfc1, d3zlfc3, d3zlfd1, d3zlfd3 automated match to d1onea1 complexed with po4; mutant |
PDB Entry: 3zlf (more details), 2.15 Å
SCOPe Domain Sequences for d3zlfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zlfb2 c.1.11.0 (B:140-433) automated matches {Streptococcus pyogenes [TaxId: 286636]} kvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevfhalkkilkerglv tavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcassefydkerkvydy tkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlterlgarvqlvgd dffvtnteylargikenaansilikvnqigtltetfeaiemakeagytavvshrsgeted stiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgiksfynl
Timeline for d3zlfb2: