Lineage for d3zlfb1 (3zlf B:0-139)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905834Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 1905840Domain d3zlfb1: 3zlf B:0-139 [236666]
    Other proteins in same PDB: d3zlfa2, d3zlfb2, d3zlfc2, d3zlfd2
    automated match to d1p43a2
    complexed with po4; mutant

Details for d3zlfb1

PDB Entry: 3zlf (more details), 2.15 Å

PDB Description: structure of group a streptococcal enolase k312a mutant
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3zlfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlfb1 d.54.1.0 (B:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry
lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava
raaadylevplytylggfnt

SCOPe Domain Coordinates for d3zlfb1:

Click to download the PDB-style file with coordinates for d3zlfb1.
(The format of our PDB-style files is described here.)

Timeline for d3zlfb1: