SCOPe 2.07: Domain d3wgwb1: 3wgw B:1-126

Lineage for d3wgwb1 (3wgw B:1-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries)
   Uniprot P12004

8. Domain d3wgwb1: 3wgw B:1-126 [236659]
   automated match to d1u7ba1
   protein/DNA complex; complexed with so4, t2b

Details for d3wgwb1

PDB Entry: 3wgw, 2.8 Å

PDB Description: structure of pcna bound to a small molecule inhibitor

PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3wgwb1:

Sequence; same for both SEQRES and ATOM records:

>d3wgwb1 d.131.1.2 (B:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d3wgwb1:

• d3wgwb1 first appeared in SCOPe 2.03
  
• d3wgwb1 appears in SCOPe 2.06
  
• d3wgwb1 appears in the current release, SCOPe 2.08