Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Domain d3w10a_: 3w10 A: [236652] automated match to d3dfcb_ complexed with ro9 |
PDB Entry: 3w10 (more details), 2.7 Å
SCOPe Domain Sequences for d3w10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w10a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals ychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemiegrm hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk hnpsqrpmlrevlehpwitanss
Timeline for d3w10a_: