Lineage for d4ohjb1 (4ohj B:40-133)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314454Protein automated matches [226992] (1 species)
    not a true protein
  7. 1314455Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries)
  8. 1314456Domain d4ohjb1: 4ohj B:40-133 [236649]
    Other proteins in same PDB: d4ohjb2
    automated match to d2tssa1

Details for d4ohjb1

PDB Entry: 4ohj (more details), 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ohjb1 b.40.2.2 (B:40-133) automated matches {Staphylococcus aureus [TaxId: 1280]}
astndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkg
ekvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d4ohjb1:

Click to download the PDB-style file with coordinates for d4ohjb1.
(The format of our PDB-style files is described here.)

Timeline for d4ohjb1: