SCOPe 2.08: Domain d4ohjb1: 4ohj B:40-133

Lineage for d4ohjb1 (4ohj B:40-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein automated matches [226992] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225594] (1 PDB entry)

8. Domain d4ohjb1: 4ohj B:40-133 [236649]
   Other proteins in same PDB: d4ohja2, d4ohja3, d4ohjb2, d4ohjb3
   automated match to d2tssa1

Details for d4ohjb1

PDB Entry: 4ohj, 1.28 Å

PDB Description: crystal structure of toxic shock syndrome toxin-1 (tsst-1) from staphylococcus aureus

PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d4ohjb1:

Sequence; same for both SEQRES and ATOM records:

>d4ohjb1 b.40.2.2 (B:40-133) automated matches {Staphylococcus aureus [TaxId: 1280]}
astndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkg
ekvdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d4ohjb1:

• d4ohjb1 first appeared in SCOPe 2.03
  
• d4ohjb1 appears in SCOPe 2.07