SCOPe 2.07: Domain d4n7kh2: 4n7k H:36-251

Lineage for d4n7kh2 (4n7k H:36-251)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)

8. Domain d4n7kh2: 4n7k H:36-251 [236641]
   Other proteins in same PDB: d4n7kh1, d4n7kl_, d4n7km_
   automated match to d4n7lh2
   complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10

Details for d4n7kh2

PDB Entry: 4n7k, 2.85 Å

PDB Description: Zinc Substituted Reaction Center of the Rhodobacter sphaeroides

PDB Compounds: (H:) Reaction Center H Chain

SCOPe Domain Sequences for d4n7kh2:

Sequence; same for both SEQRES and ATOM records:

>d4n7kh2 b.41.1.1 (H:36-251) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d4n7kh2:

• d4n7kh2 first appeared in SCOPe 2.03
  
• d4n7kh2 appears in SCOPe 2.06
  
• d4n7kh2 appears in the current release, SCOPe 2.08