| Class b: All beta proteins [48724] (177 folds) |
| Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
| Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
| Protein automated matches [226918] (3 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries) |
| Domain d4n7kh2: 4n7k H:36-251 [236641] Other proteins in same PDB: d4n7kh1, d4n7kl_, d4n7km_ automated match to d4n7lh2 complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10 |
PDB Entry: 4n7k (more details), 2.85 Å
SCOPe Domain Sequences for d4n7kh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7kh2 b.41.1.1 (H:36-251) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv
Timeline for d4n7kh2: