Class a: All alpha proteins [46456] (290 folds) |
Fold a.264: Duffy binding domain-like [140923] (1 superfamily) consist of two subdomains, each containing a three-helical bundle |
Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) automatically mapped to Pfam PF05424 |
Family a.264.1.1: Duffy binding domain [140925] (3 proteins) Pfam PF05424 |
Protein automated matches [191262] (2 species) not a true protein |
Species Plasmodium vivax [TaxId:126793] [189825] (5 PDB entries) |
Domain d4nuua1: 4nuu A:211-508 [236629] Other proteins in same PDB: d4nuua2, d4nuub2 automated match to d3rrca_ |
PDB Entry: 4nuu (more details), 1.95 Å
SCOPe Domain Sequences for d4nuua1:
Sequence, based on SEQRES records: (download)
>d4nuua1 a.264.1.1 (A:211-508) automated matches {Plasmodium vivax [TaxId: 126793]} ntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfrkl ylkrkliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvven nlrsifgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiy rwirewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqw dvlsnkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs
>d4nuua1 a.264.1.1 (A:211-508) automated matches {Plasmodium vivax [TaxId: 126793]} ntvmkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvitfrklylkrkliyda avegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrsifgtde kaqqrrkqwwneskaqiwtammysvkkrlkicklnvavniepqiyrwirewgrdyvselp tevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvlsnkfisvknaeq tagivtpydilkqeldefnevafeneinkrdgayielcvcs
Timeline for d4nuua1: