Lineage for d4nuvb_ (4nuv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016286Protein automated matches [191262] (2 species)
    not a true protein
  7. 2016287Species Plasmodium vivax [TaxId:126793] [189825] (4 PDB entries)
  8. 2016294Domain d4nuvb_: 4nuv B: [236626]
    automated match to d3rrca_
    complexed with gol

Details for d4nuvb_

PDB Entry: 4nuv (more details), 2.6 Å

PDB Description: heterotetramer structure of region ii from plasmodium vivax duffy binding protein (pvdbp) bound to the ectodomain of the duffy antigen receptor for chemokines (darc)
PDB Compounds: (B:) Duffy receptor

SCOPe Domain Sequences for d4nuvb_:

Sequence, based on SEQRES records: (download)

>d4nuvb_ a.264.1.1 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
mkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvnntdtnfhrditfrklylk
rkliydaavegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlr
sifgtdekaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiyrwi
rewgrdyvselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvl
snkfisvknaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs

Sequence, based on observed residues (ATOM records): (download)

>d4nuvb_ a.264.1.1 (B:) automated matches {Plasmodium vivax [TaxId: 126793]}
mkncnykrkrrerdwdcntkkdvcipdrryqlcmkeltnlvhrditfrklylkrkliyda
avegdlllklnnyrynkdfckdirwslgdfgdiimgtdmegigyskvvennlrsifgtde
kaqqrrkqwwneskaqiwtammysvkkrlkgnfiwicklnvavniepqiyrwirewgrdy
vselptevqklkekcdgkinytdkkvckvppcqnacksydqwitrkknqwdvlsnkfisv
knaekvqtagivtpydilkqeldefnevafeneinkrdgayielcvcs

SCOPe Domain Coordinates for d4nuvb_:

Click to download the PDB-style file with coordinates for d4nuvb_.
(The format of our PDB-style files is described here.)

Timeline for d4nuvb_: