Lineage for d4n7kl_ (4n7k L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255330Protein L (light) subunit [81477] (3 species)
  7. 2255331Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
    Uniprot P02954
  8. 2255389Domain d4n7kl_: 4n7k L: [236618]
    Other proteins in same PDB: d4n7kh1, d4n7kh2, d4n7km_
    automated match to d1qovl_
    complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10

Details for d4n7kl_

PDB Entry: 4n7k (more details), 2.85 Å

PDB Description: Zinc Substituted Reaction Center of the Rhodobacter sphaeroides
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d4n7kl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n7kl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d4n7kl_:

Click to download the PDB-style file with coordinates for d4n7kl_.
(The format of our PDB-style files is described here.)

Timeline for d4n7kl_: