Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries) Uniprot P02953 |
Domain d4n7km_: 4n7k M: [236617] Other proteins in same PDB: d4n7kh1, d4n7kh2, d4n7kl_ automated match to d2j8dm_ complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10 |
PDB Entry: 4n7k (more details), 2.85 Å
SCOPe Domain Sequences for d4n7km_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7km_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hgm
Timeline for d4n7km_: