Lineage for d4n7fa_ (4n7f A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328562Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1328563Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1328669Family b.72.1.0: automated matches [227264] (1 protein)
    not a true family
  6. 1328670Protein automated matches [227055] (1 species)
    not a true protein
  7. 1328671Species Human (Homo sapiens) [TaxId:9606] [226058] (4 PDB entries)
  8. 1328672Domain d4n7fa_: 4n7f A: [236614]
    automated match to d4n7fb_

Details for d4n7fa_

PDB Entry: 4n7f (more details), 1.1 Å

PDB Description: Crystal structure of 3rd WW domain of human Nedd4-1
PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4n7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n7fa_ b.72.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsflpkgwevrhapngrpffidhntktttwedprl

SCOPe Domain Coordinates for d4n7fa_:

Click to download the PDB-style file with coordinates for d4n7fa_.
(The format of our PDB-style files is described here.)

Timeline for d4n7fa_: