Lineage for d3phma_ (3phm A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11959Superfamily b.13.1: PHM/PNGase F [49742] (2 families) (S)
  5. 11969Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)
  6. 11970Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49747] (1 species)
  7. 11971Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries)
  8. 11974Domain d3phma_: 3phm A: [23661]

Details for d3phma_

PDB Entry: 3phm (more details), 2.1 Å

PDB Description: reduced (cu+) peptidylglycine alpha-hydroxylating monooxygenase (phm)

SCOP Domain Sequences for d3phma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phma_ b.13.1.2 (A:) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
tipaeanipi

SCOP Domain Coordinates for d3phma_:

Click to download the PDB-style file with coordinates for d3phma_.
(The format of our PDB-style files is described here.)

Timeline for d3phma_:

  • d3phma_ does not appear in SCOP 1.57