SCOPe 2.08: Domain d4lsya_: 4lsy A:

Lineage for d4lsya_ (4lsy A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (3 proteins)
   Pfam PF05016

6. Protein automated matches [190809] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)

8. Domain d4lsya_: 4lsy A: [236605]
   automated match to d1z8ma1
   complexed with cu, flc; mutant

Details for d4lsya_

PDB Entry: 4lsy, 1.9 Å

PDB Description: Crystal structure of copper-bound L66S mutant toxin from Helicobacter pylori

PDB Compounds: (A:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4lsya_:

Sequence; same for both SEQRES and ATOM records:

>d4lsya_ d.298.1.2 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvslvylvkddelillrlgshself

Timeline for d4lsya_:

• d4lsya_ first appeared in SCOPe 2.03
  
• d4lsya_ appears in SCOPe 2.07