Lineage for d4ktdl2 (4ktd L:108-208)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1518572Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (4 PDB entries)
  8. 1518576Domain d4ktdl2: 4ktd L:108-208 [236604]
    Other proteins in same PDB: d4ktdl1
    automated match to d2fb4l2
    complexed with gol, so4

Details for d4ktdl2

PDB Entry: 4ktd (more details), 2 Å

PDB Description: fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
PDB Compounds: (L:) GE136 Light Chain Fab

SCOPe Domain Sequences for d4ktdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktdl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4ktdl2:

Click to download the PDB-style file with coordinates for d4ktdl2.
(The format of our PDB-style files is described here.)

Timeline for d4ktdl2: