Lineage for d1opma_ (1opm A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11958Fold b.13: PNGase F-like [49741] (2 superfamilies)
  4. 11959Superfamily b.13.1: PHM/PNGase F [49742] (2 families) (S)
  5. 11969Family b.13.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)
  6. 11970Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49747] (1 species)
  7. 11971Species Rat (Rattus norvegicus) [TaxId:10116] [49748] (3 PDB entries)
  8. 11973Domain d1opma_: 1opm A: [23660]

Details for d1opma_

PDB Entry: 1opm (more details), 2.1 Å

PDB Description: oxidized (cu2+) peptidylglycine alpha-hydroxylating monooxygenase (phm) with bound substrate

SCOP Domain Sequences for d1opma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opma_ b.13.1.2 (A:) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus)}
neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
kyfvlqvhygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
tipaeanipi

SCOP Domain Coordinates for d1opma_:

Click to download the PDB-style file with coordinates for d1opma_.
(The format of our PDB-style files is described here.)

Timeline for d1opma_:

  • d1opma_ does not appear in SCOP 1.57