Lineage for d4ll4d_ (4ll4 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852606Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 1852634Domain d4ll4d_: 4ll4 D: [236599]
    automated match to d2ifqa_

Details for d4ll4d_

PDB Entry: 4ll4 (more details), 2.7 Å

PDB Description: The structure of the TRX and TXNIP complex
PDB Compounds: (D:) thioredoxin

SCOPe Domain Sequences for d4ll4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ll4d_ c.47.1.1 (D:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d4ll4d_:

Click to download the PDB-style file with coordinates for d4ll4d_.
(The format of our PDB-style files is described here.)

Timeline for d4ll4d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ll4b_