SCOPe 2.06: Domain d4ll1b_: 4ll1 B:

Lineage for d4ll1b_ (4ll1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d4ll1b_: 4ll1 B: [236596]
   automated match to d2ifqa_

Details for d4ll1b_

PDB Entry: 4ll1, 2 Å

PDB Description: The structure of the TRX and TXNIP complex

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4ll1b_:

Sequence; same for both SEQRES and ATOM records:

>d4ll1b_ c.47.1.1 (B:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d4ll1b_:

• d4ll1b_ first appeared in SCOPe 2.03
  
• d4ll1b_ appears in SCOPe 2.05
  
• d4ll1b_ appears in SCOPe 2.07
  
• d4ll1b_ appears in the current release, SCOPe 2.08