Lineage for d4ll1b_ (4ll1 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368271Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1368335Protein Thioredoxin [52835] (15 species)
  7. 1368455Species Human (Homo sapiens) [TaxId:9606] [52842] (29 PDB entries)
  8. 1368478Domain d4ll1b_: 4ll1 B: [236596]
    automated match to d2ifqa_

Details for d4ll1b_

PDB Entry: 4ll1 (more details), 2 Å

PDB Description: The structure of the TRX and TXNIP complex
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4ll1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ll1b_ c.47.1.1 (B:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d4ll1b_:

Click to download the PDB-style file with coordinates for d4ll1b_.
(The format of our PDB-style files is described here.)

Timeline for d4ll1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ll1d_