SCOPe 2.05: Domain d4ktdl1: 4ktd L:2-107

Lineage for d4ktdl1 (4ktd L:2-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (5 PDB entries)

8. Domain d4ktdl1: 4ktd L:2-107 [236595]
   Other proteins in same PDB: d4ktdl2
   automated match to d2mcg11
   complexed with gol, so4

Details for d4ktdl1

PDB Entry: 4ktd, 2 Å

PDB Description: fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate

PDB Compounds: (L:) GE136 Light Chain Fab

SCOPe Domain Sequences for d4ktdl1:

Sequence; same for both SEQRES and ATOM records:

>d4ktdl1 b.1.1.0 (L:2-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
pvltqptslsaspgasarlsctlssgftvgrysifwyqqkpgsppryllyyfsdssqhqg
sgvpsrfsgskdasanaglllisglqsedeadyhcaiwhsgawvfgggtrltvlg

Timeline for d4ktdl1:

• d4ktdl1 first appeared in SCOPe 2.03
  
• d4ktdl1 appears in SCOPe 2.04
  
• d4ktdl1 appears in SCOPe 2.06
  
• d4ktdl1 appears in the current release, SCOPe 2.08